SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068NV06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068NV06
Domain Number - Region: 54-121
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0942
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068NV06
Sequence length 164
Comment (tr|A0A068NV06|A0A068NV06_9BACT) Transcriptional repressor NrdR {ECO:0000256|HAMAP-Rule:MF_00440, ECO:0000256|SAAS:SAAS01000175} KW=Complete proteome; Reference proteome OX=661478 OS=Fimbriimonas ginsengisoli Gsoil 348. GN=OP10G_3829 OC=Fimbriimonadaceae; Fimbriimonas.
Sequence
MQCPFCGGADQKVLDSRPCIDGEAIRRRRECLACGRRFTTFERPERPRIFVIKRDGTRAE
FSRDKVFDSMRIACRKRPVSVETIRVLSERIERDLYQDFEDEVTTKEIGARVMRELAPVD
TVAYVRFASVYQEFETVSDFARLIEEVQREQSLAPYRGLQESLL
Download sequence
Identical sequences A0A068NV06
WP_025228886.1.45701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]