SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068NZB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068NZB0
Domain Number 1 Region: 136-279
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.18e-54
Family AadK C-terminal domain-like 0.00000384
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.14e-42
Family AadK N-terminal domain-like 0.00000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068NZB0
Sequence length 288
Comment (tr|A0A068NZB0|A0A068NZB0_CAMCO) Putative adenyltransferase {ECO:0000313|EMBL:AIF29629.1} OX=195 OS=Campylobacter coli. GN=aadE OC=Campylobacteraceae; Campylobacter.
Sequence
MRSEKEVYDIVLNFAKTDKRIRMVTLEGSRTNTNIPPDDFQDFDITFFVTDMDSFTSDDK
WLDIFGERLILQKPEDMELFPAVEKGFSYLMLFTDDVKIDLTLLPLELIDEYFTWDKLVK
LLLDKDNRIVKPPIPTDIDYHLQKPTQRMFDDCCNEFWNTTTYVVKGLCRKEILFAIDHM
NDIVRKELLRMISWLIGIKQGFHFSLGKNYKFMKQYVTEELWERLMSTYNMDSYPHMWES
FEQCMALFREVSSKVACQLDYQYPLYDEKISNYVIRQKKKYGIEDDNK
Download sequence
Identical sequences A0A068NZB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]