SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068QQ19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068QQ19
Domain Number 1 Region: 29-165
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000000116
Family Apolipoprotein A-I 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068QQ19
Sequence length 178
Comment (tr|A0A068QQ19|A0A068QQ19_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:CDG16884.1} KW=Complete proteome; Reference proteome OX=351671 OS=Xenorhabdus doucetiae. GN=XDD1_1181 OC=Morganellaceae; Xenorhabdus.
Sequence
MKKTILGSLIVAGIVALLAGCDDASKKAENTAQQTEENATQMKTDAEKTITDVKDHTKEN
SQEIKENAAREGHSLIDKSKEVQNQITHSANDVTEQVKSKLADMQDQATKAANDVMDNVK
AKTGELQHQASDKIDQLSEAMKSKTEDVKSEADKKTDELISSFKGHHLNDDKDKKEEN
Download sequence
Identical sequences A0A068QQ19
WP_045969398.1.77598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]