SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068R8V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068R8V2
Domain Number 1 Region: 10-144
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 5.49e-57
Family Immunodeficiency virus matrix proteins 0.00000166
Further Details:      
 
Domain Number 2 Region: 139-171
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 0.0000000000000628
Family Retrovirus capsid protein, N-terminal core domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068R8V2
Sequence length 172
Comment (tr|A0A068R8V2|A0A068R8V2_9HIV1) p17 protein {ECO:0000313|EMBL:CDG23687.1} OX=1367762 OS=HIV-1 M:B MS2016. GN=gag OC=Lentivirus; Primate lentivirus group.
Sequence
LAEARRREMGARASVLSGGKLDQWEKIXLRPGGKKKYRLKHXSMASRELERFALNPGLLE
TAEGCRQLLGQLQSSLKTGSEELXSLXNXIATLYCVHQRIEVKDTKEALXXIEEEQNKSK
NKAQQAAAATGSSSQVSQNYPIVQNLQGQMVHQALSPRTLNAWVKVVEEKAS
Download sequence
Identical sequences A0A068R8V2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]