SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068RU24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068RU24
Domain Number 1 Region: 485-626
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.02e-26
Family Regulator of G-protein signaling, RGS 0.0022
Further Details:      
 
Domain Number 2 Region: 1042-1155
Classification Level Classification E-value
Superfamily PX domain 2.22e-23
Family PX domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068RU24
Sequence length 1453
Comment (tr|A0A068RU24|A0A068RU24_9FUNG) Domain-containing protein {ECO:0000313|EMBL:CDH53683.1} KW=Complete proteome; Reference proteome OX=1263082 OS=Lichtheimia corymbifera JMRC:FSU:9682. GN=LCOR_05014.1 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MPTVSIESLRAPYILVLVLIPLWLLWPHTFHYVLWAIALILTTVLALVFFNIAVLLVYIR
YFLSPTKHKPQDFKPLRFASEKIWASIEQRRQQENDDGTNTPPPLDVAPESKEVSDAFEQ
LLSYVLRDFIDYWFVYVAGPHERSFRKKVDELIRLSVVALKKRIQEADLVGILVNRLVPI
ITAHISDFRAAEIALRGRSLERSVTQSDELDLLLASQFRNGRLHSALTTAAVTTKPTEVV
HLRKVIEHVMPCVMDHKELSSTPVSVLIREIVSCAILQPVIDMVADPDYWNQTIDTYLGK
AIREQKMVHKLREVLNRHSTELDLEEALAAAKPQPSPINGGPRRPSRNRSRPELLPASSL
SSIFDQADNAFSRIRMGKRSFQEFLRMIEDEKNLLELKRVRNDIVTQLRKKRVQIHDRDP
DEVIDGERVGDITIYLNRLSVAKRRVDKRIALLTGQTYDKGFGRTFFGGSSHRRRSEAFP
SQPFGYSLDDILANPAGLSYFMEFMDRRGDIMKLQFWLIIEGFKKSDPSSQSASTFLQDV
NMVYTMYLMESAPHRIILPDPLADDLYEAISRAEHAIQDSPLEIPHAVQRMRLRLYEIQR
HVFYQLEKDHFPYFKRSDLYFKFLASTPNVIQEPAIPEHTCIDVTPSNQSSTGSIIDAIR
PVPLQRTSSASMSKHKSSWDDGPLDQACRAESDTEISKGNRAKQQQDQVEKSARGHARTI
SETAHGGITRFLEWGKTSAHDWWGGIESNGTDMDEENNSSNSSQRQSLQSFDTDDLSTEE
DDDVDDQSTTAVDEHIPQQDDIPPPPLSTSASSRHPLVRTNTVKAVEAELQSIIDWDDST
GTTTDDNGKVGKRKISSGSSTLSFSPPPTPSPKKQISSPLLLRDSRGAKSTTAVPVQHGV
TLQSWASSTGSSVIREISDDTQGFDDQNMLKTMSSEQPTEDGSLQQDQHTKSDTANVHLA
PPGDLMLSSAIERLSDEMEKLMQQQAIVDQLIKKAEASNMGEKLRILKKSKAMFRQEIQQ
LEYQKNQYEAQESENVLIPHRTRVSVTSSTIGNDAAGDFALYVIEIQQLGIEGNYNSGWM
VARRYSEFFALHTKLKERYAIVKNLEFPAKWPLLRLQKGFVEGRRATLERYLRRLLEDRD
ICQSRELRAFLSQQSVHGGFDGIVPSRSAGMKSSDLLKQQLQPSSSTSSTASSKSFQRSS
GNNNDIIPTEQALQTGFMRNIYKSVAEGIDDLSVAPSMLDFITQQLVGKQFVGFIDEEAN
AKETNDTSATGFHATTTTAVPPDFVDPLKDQAEEATNLTESLCDLFVEMFELKEKNNWLR
RQALVIILQQILGGTIERRLRDTVVFLESEPMIVFYLRKILDSLWPGGQSLTFKPPRQPD
EKQRTKEAANRKLSTWLPDLIGQMVGRQNARRGARRLFTVLQNKRLNQDLLYTLFDEIVS
ALFPEIDLSSCKV
Download sequence
Identical sequences A0A068RU24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]