SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068S6B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068S6B3
Domain Number 1 Region: 448-541,587-617
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.23e-25
Family Regulator of G-protein signaling, RGS 0.0016
Further Details:      
 
Domain Number 2 Region: 202-295
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000305
Family DEP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068S6B3
Sequence length 649
Comment (tr|A0A068S6B3|A0A068S6B3_9FUNG) Probable regulator of g-protein signalingprotein {ECO:0000313|EMBL:CDH57913.1} KW=Complete proteome; Reference proteome OX=1263082 OS=Lichtheimia corymbifera JMRC:FSU:9682. GN=LCOR_08801.1 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MPNSASSMATYTTLMRVTSGGRPYCQDLNDLFAALVIQHGLRDHRYRFRTIPNSFVFAEA
IEVLGHLQFTHIIKAPDPADPSRLIATRTTTTFSMSPKMGKTLAQHFATSRLLENAIDPS
NRVMKDKAIWLLSPKGKYVIQDFSHRARVSIQSLQSALTKIDAFNVVVLERLSDRDDRLA
FARPNMTIAFKTMMAYLPMESLLADDAGGIEKKDLEEFQYAFYGYQAFEWISEYTTVVTR
EEAEMVASEFVLYGWIAQVIDKSDRENSTKDESIMFKMGRNTMYHVTGRGRQVLGWDKPY
QYGDDSEEGSLADTHEKVLQRQRALASRLRHDTSSTKSAPTVHPTPSKKTVASSISSGSS
SAESEPASDDVPHMPDDHSSSTPNSNSERHSSDKPQKDIDEVTERLLQLRSPGGVQRQRS
NSASTSSSSRPSSMIFSNHDHNIDPNSHWAKLRQILQDPLIRMYFRDFLKSQFCEENVNI
WVDYYTMRKKAKKPNVSTKELLQDAYAIYDTYLAPNAHSEVNIDHQLRHEIIAYVSSTFS
VFNNETGSAPAGSIPFVSSAFQPTHQQQITLVVNGHASHCLRNMLKLYDRVDDHICRIMA
QDSVPKFIKTEKYRELIANPPQSASVTRRNSVGRQLVVDDDDDDDLDDL
Download sequence
Identical sequences A0A068S6B3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]