SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068SB34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068SB34
Domain Number 1 Region: 130-447
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.83e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.023
Further Details:      
 
Domain Number 2 Region: 13-79
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000014
Family Regulator of G-protein signaling, RGS 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068SB34
Sequence length 696
Comment (tr|A0A068SB34|A0A068SB34_9FUNG) Apoptosis inducing factor {ECO:0000313|EMBL:CDH58486.1} KW=Complete proteome; Reference proteome OX=1263082 OS=Lichtheimia corymbifera JMRC:FSU:9682. GN=LCOR_09345.1 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MSAISTNNSSHLLQSVLSDPKLLRSFETYLHRINAHQNLLFIEAMSQLRYDYSKTPEIAL
RRIHKSFFSEDSKLVLSNITTKAKVNAEIEDLQWAIIRREDAVAVLLETEEQVLEVLQSK
LDEFIRAKKINIMSIKQPPCKYQVRVVIIGGGFSGFTVASILDPMPLFHVTVIDTKDSFE
YTPGIIKRLVNPEESSSMRVRHDAYVRNGRVIIGYATKIDDGAKSLQVNGETLCFDYLVI
ATGSSYASQFKSTDVSVLYRMTGLEQTHSDLLNAKKVLIVGGGLVGCELASEIALRTFPG
KYPHKAVTLVDSHPQVINRSETTQRDKAMNYLAELGIEVVTNERIFFVEGSENAGLYRGT
SGRVYTGYDMVFMATGTRPNSQLLQNSNDLDCCVDNWGRICVKPTLQINHYKYQHIFAGG
DATNIAEEKTGYAATLAGVCIARNICRMVKGKAPLRQGTKGTIPAPDKPLHGISSQGGIG
KQKLGTIRRRFAFLNPAWAALKMFDEQQYLKMVQGEAINSTQVFGRMPRRLTLPSGYARP
LTHSVSAVSLDVDEEEFDDRYHSLPPVPQVPSRYKPKQSQSYHTSAKNSEDSVYHHGKGK
FGTWSSSSTVSSMDGSSTGSSSSGSLLNDFVNNHFQFGVNAFDQQQAATEDGASVSSKAS
TVKSHHHQRRHSPRSRSPRRRSSMPAIDQIFNAWHI
Download sequence
Identical sequences A0A068SB34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]