SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068U8F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068U8F5
Domain Number 1 Region: 141-198
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000413
Family SAM (sterile alpha motif) domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068U8F5
Sequence length 201
Comment (tr|A0A068U8F5|A0A068U8F5_COFCA) Uncharacterized protein {ECO:0000313|EMBL:CDP03893.1} OX=49390 OS=Coffea canephora (Robusta coffee). GN=GSCOC_T00016395001 OC=Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea.
Sequence
MYADRVEAASKRSVKDRLNGNSAGDSARRRQITGKRQREDDKWEHDLFEDDEPKFSNRRI
GASDLRLKLQKKSIQRATQNVRGSLPGGVRDLREKLSGTIYSQAMDTDPPKPKPASEVGR
PARKSVIAEAPVASEKKAAASSVESVDSFLQSLGLEKYSITFQAEEVDMTALLHMTDEDL
KAMGIPMGPRKKILLALESKV
Download sequence
Identical sequences A0A068U8F5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]