SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068V3E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068V3E2
Domain Number 1 Region: 202-304
Classification Level Classification E-value
Superfamily TAZ domain 2.49e-20
Family TAZ domain 0.00059
Further Details:      
 
Domain Number 2 Region: 23-92,127-157
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000022
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068V3E2
Sequence length 355
Comment (tr|A0A068V3E2|A0A068V3E2_COFCA) Uncharacterized protein {ECO:0000313|EMBL:CDP15082.1} OX=49390 OS=Coffea canephora (Robusta coffee). GN=GSCOC_T00042645001 OC=Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea.
Sequence
MKENLAVKVNGGTTTGEMHAATEVTADVHIITSGGVRIPANSAVLASASPVLESIIDRPR
KHRSSDKTISILGVPDDAVSVFVQYLYSSKCSEEQMEKYGIHLLALSHVYLVPQLKQRCN
KGLVERLTVENVVDVLQLARLCDAPDLYLKCMKMLSNNFKSVEQTEGWKFLQNHDPWLEL
DILQFIDEAELRKKRTRRHRQEQSLYLQLCEAMECLEHICTEGCTSVGPYDKEPGKNKGP
CSKFSTCQGLQLLIKHFATCKRRVNGGCLRCKRMWQLLRLHSSICEQPDVCRVPLCRQFK
LKAQQEKKGEDARWKLLVRKVISAKALSSLSLPKRKREEEPRLNLSHPGMRSFTL
Download sequence
Identical sequences A0A068V3E2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]