SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068V5Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068V5Z9
Domain Number 1 Region: 33-136
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.96e-26
Family Steroid-binding domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068V5Z9
Sequence length 244
Comment (tr|A0A068V5Z9|A0A068V5Z9_COFCA) Uncharacterized protein {ECO:0000313|EMBL:CDP16086.1} OX=49390 OS=Coffea canephora (Robusta coffee). GN=GSCOC_T00017103001 OC=Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea.
Sequence
MLWSPFLGIPLVIALISFVFFKIFPLSSLISSPPPLQPRLFSAEELSFYNGSDPQLPIYL
AIVGSVFDVTKGKSHYGAGGGYNHFAGRDASRAFVSGNFTGDGLTDSLQGLSSPEVKSVV
DWRDFYFKTYIYVGKLGGRYYDSKGNPTKYLKGVEAKAARGAQLLEKQKDEEAKVPSCNS
RWSQDEGSEVWCDDGYPRLVQRPIEIALTGKMSKRCACYKEDELEQAGLEVYEGCDFFAK
KCRI
Download sequence
Identical sequences A0A068V5Z9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]