SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WGQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068WGQ6
Domain Number 1 Region: 229-358
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-43
Family Regulator of G-protein signaling, RGS 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068WGQ6
Sequence length 472
Comment (tr|A0A068WGQ6|A0A068WGQ6_ECHGR) Regulator of G protein signaling 3 {ECO:0000313|EMBL:CDS18945.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000422200 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MSESRATVPVQVPNIEVTENLTSSSHLSASVERLVEVTRRLTVCNQLQSALNSQTDTTEC
PDDKYKTAPTSDVPLELAEEERIKPTTGTAHSSETSSTCNLATPDSKTGQSPQCTTKKWA
RLLGISSEDIGDEEEFIRAATAITAHVPARQSNTMSVAEQRALRQSWNAALDAAHFGSLE
SMESTSGNSLRRSSSWKDKMSLPFFSKRCTQVKTVQQDELLKMIASGKPSYEQVHRWRKS
FEALLADKYGLALFKEFLATEFSDENIEFWIACEEYKTITQPKKQQAKAQKIYEDFIATQ
ACREINLDSVTREQTIAELASPSTHTFENAQKRIQALMERDSYGRFLRSDLFLTLLNQAK
QAARELAAAARDGHEGGGGNLSGESSARFRLLNFMGGGGGVSGPLRAGGVGTDLPGVLAA
AADAEAGMNSVQDLELLGLSTSRHMRNMTKNAANKRSTSSGKSSTSPAKAPV
Download sequence
Identical sequences A0A068WGQ6
EgrG_000422200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]