SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WL93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068WL93
Domain Number 1 Region: 357-487
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.24e-38
Family Regulator of G-protein signaling, RGS 0.0000664
Further Details:      
 
Domain Number 2 Region: 7-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-16
Family DEP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068WL93
Sequence length 535
Comment (tr|A0A068WL93|A0A068WL93_ECHGR) Regulator of G protein signaling 7 {ECO:0000313|EMBL:CDS20867.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000522500 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MGLHDEIRKIEDLIKAIHETDTGISFKPQKVFLTSIPAAVSGDSLIAWIKLYLKIDDPQE
AAHIANILLLYGYVYPLTDHESYTVKDDPTALYRFQAPYYWISKVPKFDQMDYAIYLVRC
TLRKRQRYGLEDYEQRALHRLQIVLARKWDFICMQAADQERLHRDRRKIDQIVLEAQERA
FWRVHRPPPSRLSCFEERLPRNEHMIRRPLTWRQAYVSISSEKDRKFQLRSLEPRTLPKP
RAPLSPRQPPPQALPHSHLCLSAKKSIENLLYFAANRSSYDWFLGEVGGGGAGSGSCSFH
AASPWLSQPSNIETSPCMPLIGLPTCDSLLTSTPLGSCLSTDPQAEPCTEPLDDPSIPFP
TINQVRLWATSFDNLLWDPSGCQAFKAFLEKEFSSENLRFWLSVNAYQFTPVSNLKVAGQ
RIYDEFLGPNAPSEINIDCSTRANTTKAVKNPSWYVFMDAQQQIYKLMKSDSYARFLRSN
DYSAVLRRVLAGNSHRGDRHKSRRSLRRPLSLSTATSTSSALDEGSCTSGSTPTP
Download sequence
Identical sequences A0A068WL93
EgrG_000522500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]