SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WLS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068WLS3
Domain Number 1 Region: 74-236
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.65e-26
Family Regulator of G-protein signaling, RGS 0.00013
Further Details:      
 
Domain Number 2 Region: 838-916
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.27e-26
Family DIX domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068WLS3
Sequence length 918
Comment (tr|A0A068WLS3|A0A068WLS3_ECHGR) Axis inhibition protein axin {ECO:0000313|EMBL:CDS20712.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_001141200 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MSYPPGSLRSCHEADGRSDRSGGSGGTGSGSGCGNVYGSLYGAFSDCKWHHQAQQHQQQS
HHQAQKSQQQLEQVQSTWQKWAASFDALLSDGEGVALFKSYLESEGCGNLLDFWFAIQGF
RSKVDPSDRKKILQLIKVIYQTYIRGSASASASASSSGVPPPSATTASRSRRNHTPVRLR
PETRRSIADRLAHKSSLDQTVFDEAQAEVGHLLRTTAYQAFLKSEAFIAHIQQGGLGPKP
ALMCSEDEFTRHTAYLPTVEEDRELGQAPLPLRGSSTPATYHYFCGPPMLQQQCACQSGN
PWGVTYYPPPTPQTCYPPAPLTQENIQMTRFQRAELPVPQHLACCPHCQTPLPQQQQIPG
PSNPLSPTQHKSMGRMTGAGQRKWMDAVCPKYEYCSPPLAPQGGFARAPPNPYHVSFAPV
SMQDSEHHSLSSGAHTEENLSHIDGACDEARARMHLSSIRHTTRISTNYPVFETSTTTTP
AAVITSGGGGGGGSALGHKHKRGVSSSRRAAVNGASTAAAGAAATSKTATLRDQNMAELD
PSGFARLLNERLQRVVEDRAAMERLERLMSEVGNDEEGEETTEIPDTGQEKEASTKTTEA
VKVEPKTETEIASATKTQQPQPLLTTAESEECSISKAMANLSVASTSTTTTTTTTTATVS
TKPSVLQRPWADRLLAAARVQHAQQGDNAQAILEDHCSRIWDTSADRTPTSSSGSGGDGH
GAFALRPRLDAVGKSSGKIVETSRQATTGGGGEEEEVEDDCIHPPLLQESSSPPSATTTT
TTNSSTRFDFHQQVNESQLVDVNTMRLQARCTASPTAPSTTGGGGSVGSGGSSGSGGLVV
GYYLCDDPVPYRSQWPSNVITLGQFKHLVPKKGLFRFFFKTTSDEFDSGVVHQEISNDDA
VLPLWEGKVVAKVERVEQ
Download sequence
Identical sequences A0A068WLS3
EgrG_001141200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]