SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WQV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068WQV1
Domain Number 1 Region: 45-177
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-40
Family Regulator of G-protein signaling, RGS 0.0000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068WQV1
Sequence length 210
Comment (tr|A0A068WQV1|A0A068WQV1_ECHGR) Regulator of G protein signaling 3 {ECO:0000313|EMBL:CDS20840.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000518700 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MWKLTAAAALRHQKQTEAAASSPSSSALNSEEVIVQGLLRSIFKHSWPTLQQVTCWQHSF
QNLLQDPHGLLVFREFLQGEFSDENLEFWIACQKYKALTDESLQRLRAQEIYDGFIAFQS
QREVNLDCETRLQTELRLSQAEPDLFDASQKRIEALMEKDPYRRFLRSTLYLKLVGFCQK
QEGSNSTPTDSKTVEPPFALPKPSNSASVH
Download sequence
Identical sequences A0A068WQV1 A0A068XZP4
EmuJ_000518700.1 EgrG_000518700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]