SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WV58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068WV58
Domain Number 1 Region: 719-776
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000284
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0083
Further Details:      
 
Domain Number 2 Region: 592-639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000116
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 813-872
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000241
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0074
Further Details:      
 
Domain Number 4 Region: 649-688
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000497
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  A0A068WV58
Domain Number - Region: 919-937
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00379
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068WV58
Sequence length 997
Comment (tr|A0A068WV58|A0A068WV58_ECHGR) SPONdin extracellular matrix glycoprotein {ECO:0000313|EMBL:CDS23708.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000929500 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MVCPKVVFTVLLGALWQVFGEFVLPEHCYRFARGPSRALRNSANNDDGFEISVRRSYDGA
RVGAWFEPEKEYLVTLKNELPLVTFDDFLFWLTPTEPPMMDPSDGKYTTRDCTMSPGKCV
GSWVHTLNRMGSRLPWQNRRRNRHAGQVLTRNRPGCRGLVVEGLHSFSGRYPPLIRQMGR
IVLLWRSPNASRHNCVTLHAMVRTRTSVLKEVGGLMKTLCPTEMRPMEPVISRIRESLDV
DRNDPTVYLQPPYANPMQTTLRDSVQPKDCCSCGTATYRLTFQGLWNRSTHPQDWPTKNP
NLLHWTNLIGASHAPSFQIYAIGQTASAGVQSVCAYGDTTVLREALSLAAAKAEGAAGVP
TGSQSATTDISPLRALIFTPGMWGEETLMERRTTLFSVNRTHPLFSMLTMLGPSPDWCTG
ISGQSLCKADCTWVRNMTLYLHPWDAGIREGNTYMPKESDRKEIPDPIRYIDESWMPGNP
FRKKKPIALVKLERVLPKHDWECTNKDADGVQLFLMGGGIRVTGKKPSDGMDPGKRKDQM
HSASATQQIVTGKGRGKSSKSVGFGGPGASGTLGTNNPLSDPSLAQMATFLCITSEWSGW
SACSVTCGVGTKTRTRQLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSFLPWTLWS
PCSATCEHQVGTRSRTRALARPEEAEQCKHLWAGKEGGMESVMKEVEECRIPPEACEPAT
ICGEGPKQGYPCGQKRRRFYYSAIDHECLEFEYLGCKGGRNMFETKEKCEKLCIPAVEAL
PAWRRERMGLLQFKTSQLAATSGDSKEEELKQDPACHYEVNTGYECDPPKQLGNYWYYCS
RTNRCRDFFYLGCGGTPNRWANHTACMAACMPNELRQLQLLAKVRVATGSRRSDKDRGDG
KYGEAEAPDGLKVEVSPKQDCRVTSWGGWGPCSAKCANLLDMAALPVDRSTRSGNATETM
THVKWPTCLLDTLKLIFGVFKQYIFPDFNFAESGTNH
Download sequence
Identical sequences A0A068WV58
EgrG_000929500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]