SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WVI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068WVI7
Domain Number 1 Region: 566-601
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000157
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068WVI7
Sequence length 612
Comment (tr|A0A068WVI7|A0A068WVI7_ECHGR) cAMP dependent protein kinase regulatory subunit type I II alpha beta {ECO:0000313|EMBL:CDS24172.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000724900 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MFFSGGLGAVIKKYTEMQVEDSDGEKLDYFSDVIPVACPRSKTLVPRNPFGCASERHAEI
RRTSLLKNRKCVLQNRIKSSTLVPSSSRGSGANITCRRRIIAPIEELKYALARGTTGPSL
LRSSDRGRGAHKRRRSLSSNLRTLMPIEEFEPKLRVHIKRASSFSLPDRDRMGYGTTSSE
RQTPSTSEEIENASWVAINRRPSSFQRHRVLGTPKWFNPLSTSSTVDTCCEPPLKRPLLS
RFNLSRMERLSSGLKGSISSKDRVLSWILSQLYLHREKDRSSMLSFDFSTDITPSTINQA
TFSESLRAIAEDGTDVGFYECSVNADTNDKSVLVNTRSEYSIADTEYCTILTSKLDSQLN
LLNETNEYTRKTKDQVIKRIIRTHRELDNLIVEIEEWVNTESTKSTRRQSLSELGWYLAN
GAVLVVERIYAITSAETKFTVNTLDTDGVVCNLVCEHLCERNVSYDNKNVSELAMKQTIV
SPTGSSFTTHKYFTVHGQLLSLVQVGLPIVFKTVDLPSLVTKTQYLPPPNITDNDFHWRD
NYMLYSRFHERKEELKSQYHLYLYNHPEFVDMVKDFLQSILMEKPEDTLNFAADFFTTFS
KRQLLPPRLKRT
Download sequence
Identical sequences A0A068WVI7
EgrG_000724900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]