SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WVY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068WVY5
Domain Number 1 Region: 12-104
Classification Level Classification E-value
Superfamily SNARE-like 5.95e-20
Family Clathrin coat assembly domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068WVY5
Sequence length 132
Comment (tr|A0A068WVY5|A0A068WVY5_ECHGR) Coatomer protein complex subunit zeta 1 {ECO:0000313|EMBL:CDS24010.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000145000 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MVRLACCFHFEAEITLFEGTTCVHRTTSDIYFYIIGDVNENELMLMNALTCLHDSITQIL
RGNLEKKTLLDNLELIYLAVDELCDEGIIMEYDSAALASRVGIKPEETSLSEQTVTQAMQ
AAREQIKMALLR
Download sequence
Identical sequences A0A068WVY5
EgrG_000145000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]