SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068WZF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068WZF0
Domain Number 1 Region: 172-235,273-306,378-424
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000241
Family Nucleotide and nucleoside kinases 0.0091
Further Details:      
 
Domain Number 2 Region: 18-101
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000336
Family Tyrosine-dependent oxidoreductases 0.013
Further Details:      
 
Weak hits

Sequence:  A0A068WZF0
Domain Number - Region: 600-624
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068WZF0
Sequence length 631
Comment (tr|A0A068WZF0|A0A068WZF0_ECHGR) Adenylate kinase 7 {ECO:0000313|EMBL:CDS23066.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000707300 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MMQITSDERLTDTTNKFKFLTYVIASGITYGEENDGGWLNKPTLSVIGDGKNLIPTIHVK
DLASIVFELLNLCPTTHYILAVDDGYNTLLEIVTAISEALTTGKVKHISIEEAKQMDEFT
QKHIDSLTLNLRLEAQFVHENLPFKWVSENGMVTSIERVVKEFKLARGLLPIRICILGPP
LSGKSKLAQLLSEYYSVPHIHVKGVIDDRIKELEEQVNLRHKKSSDNEGTEEEAIDEGYD
AAEDSDLNPSALLSQIKETLSSEKNRLSNAMVCSFIKKRLSSKECLNQGYVLDGFPKTRA
QADLLFGSDEAVEEEMEEMEELNEGTEEKDAKEPDPQVQVAQLDRERAARERSIPNMIDE
TQFLGKVALSPNPNSLPKGILPACVIFLQATDVFLFSRVLRIPNHEMRCSHNDEEGFLRR
LLIYRHAHAGSEVAALMASDELRKALNSEYLQKITAGEASTLTLSERIVPLMAGSVGANS
LCAFFEDRGIRAFNFDVETDTSGVFNEIERKIRAAIGPPRNYGPSTSKTVTIREKIRLKE
EEERRELEKAREAEEFRRREVRKREFSGLLERVRTEEDEALLEASKPLREFLSKFVMPTL
TKGIFECIWRRPEDPIDYLAEYLFRNNAQVD
Download sequence
Identical sequences A0A068WZF0
EgrG_000707300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]