SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068X4A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068X4A1
Domain Number - Region: 147-212
Classification Level Classification E-value
Superfamily TAZ domain 0.0314
Family TAZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068X4A1
Sequence length 232
Comment (tr|A0A068X4A1|A0A068X4A1_HYMMI) Uncharacterized protein {ECO:0000313|EMBL:CDS26930.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000155000 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MQKRSSGEVNIHPECQIKMEPKAKEILLTLFNKKWETSLVPTQWEVAIVIPMLKNGKDPS
KFDTYRPISLISILAKLMERMVKTKLAWFLEINNILGNEQVGFRSQRSTNQQVVTLSQHI
EDALDARNTLTAVFIDFESNELKPRTKEKQWTAALFNIADWPRLEAVAELRLCIGHKCLA
KHLHIIGVCAQPTCPLCDLQEEMKKTHSIRCPALQTTKETQRYWEARSQQVG
Download sequence
Identical sequences A0A068X4A1
HmN_000155000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]