SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068X4P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068X4P0
Domain Number 1 Region: 23-74
Classification Level Classification E-value
Superfamily WGR domain-like 0.000000000248
Family WGR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068X4P0
Sequence length 97
Comment (tr|A0A068X4P0|A0A068X4P0_ECHGR) Poly (ADP ribose) polymerase {ECO:0000313|EMBL:CDS24873.1} OX=6210 OS=Echinococcus granulosus (Hydatid tapeworm). GN=EgrG_000566400 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MLFVKQQATVTAISVRLQALCSDKSPRQQRVLRSWGSIGTRIGGSRVGQLVSLNAAIQCF
HDVFLKKTANSWVPSVPIFFRLQRRIFLSNWNKLIPS
Download sequence
Identical sequences A0A068X4P0
EgrG_000566400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]