SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068X7D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068X7D1
Domain Number 1 Region: 447-506
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000538
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.004
Further Details:      
 
Domain Number 2 Region: 114-241
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000116
Family Regulator of G-protein signaling, RGS 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068X7D1
Sequence length 1745
Comment (tr|A0A068X7D1|A0A068X7D1_HYMMI) Protein kinase c eta type {ECO:0000313|EMBL:CDS28051.2} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000185200 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MFIWLSSYLKISTSPPNRLTEEEVPSSLTYSDETSSCLARGQSECAEIDKPFSDGSYQTN
FSPTSAQNVQQAQAAPTAVQSSVLPSGHFLGRILNEDDTDDEQIREEICGLAARFQSATA
VLSSPSLTAVFINYLLVQNYELTPVLFYLVAKHYRWMQTHSKELAKDYLRALMEIYTTFL
HERAPFYLKLDSRVIQQMEDSVSTRDSASILDGCCEAVLPQIQLLVDKLSKDIRHGLDTW
KPPECFDLTLPLPRDEELSIYETIISPRVNELQRIVAGLNPVQFPPTSSPAAMSFISATS
AIIGWLSATSAATEVPREQLALALCASLVSAYRFFSSSIKNVTPTSSGSPSQPETPADDI
FMASAPTCPNTPVPPQHSFRKTLFAKSIENLAAASSQASGNSNLGSSNLSGSISGNLSAV
GVTNWDKLPSFNSKIKSKSSNALFGSWKSRHSQKGHSLQERSFDRVAECTVCGGLIWGLA
PQGLTCQVCDISIHHRCKSGLKEACTKDCKSSNLSRGSVSNVSMSASSGTPPNITSFSVP
RSSSIMNSSATVSQYPSLPEQTNSSAGNFTSPLEDAASSGDRGDSRSSGLTVSTEDIFHC
RNSSFNELMSESASGSPLQNPSFSPCEAPTSPIINEEAKVKRSNSGFSQTHHRGGSQVGL
TSPEPISPLPESMKPPFPLMRSSSQDLQKRHSFRKFLYSSTLNLSGYVRNAKQKMNNHSY
SGTAAALSKHTTSLMQLPIMSEREFKRSSAISQFSPYASSSAAANVPELLPTWSDDPEMN
ASESFEAENELRYHFPQYEIPTKGPRVQDHVRTLVLMEFHQKVRYMVCYLKTFDYLLLQR
WPKEHQRLADLMALDRIPQLISLFRSLVHTIEKTIEPQGYGKMAEAVLQWLTKDDETNLK
AWVRDCQALSCTNMLDSVKAMIREYSRKHPDIQPVLETRFNKFVLVECLSQVRILYFNLP
LISNNIMKDLEKKTSSYKAEAKIWRDIYSKLASIPHSIDKICMPLVKQINDGHFFSTIDK
GEQLTRYQAQFGNFPFADLMLQFPRTLFRYWVIDYSEIAIDKLTFTSDNKINYDYVKERT
EVLAILLDSALILLVRDGGRYYLRPFKPTKEPGMENMVASTSSLSSTQSAVASNLLGNTM
KLSPVFSTDSVFASLGEQIGHEYMLNMIFKEQAILLRLSFSCKDTRAKWLCVLKKREEIS
NQRILATHKARASLPPVSTHSSSNDLKVNTESAKPVRSSTQIAQSISVLDESPQMQESGL
SLDTSSPEAFDEQITHFTGKISEMEHDLQGLVRSISTVKNIDVNEILEKIYLNSDETVPH
SREELMIAELVMTENWLKFVKRHLRQLLHVHISGSKEKLEPFTISTTSKLHISIEKEHHQ
SISPIIAGLSDRRIRSRTRSRSNSINCARTEVTKSSLGESKEKELNSQEDEWELGNEESK
SRGRKQLIEIIHGLQNLSLVASRALRSLGPKEKEGITASEDSKSEEEQHEAFLDANSSLS
SSSSNFITGEADEPKTNEFENVRETASLEEKNPSDYENEEIEMETGDDTECQDIPDIDDY
AEIPPKVPVSKLDEELPTSLTPLATEEDECDDKEYDELKLAALQLVDEVIDAVGAFEMDI
RMIAKDLTDSAVTSAIHQVTGNSRRRSPEFACTTDSGISFIEIPGHLSSGEDDELTVTGS
KPNLGPTHTEKAHDSVVLFSDLDKLDMDRLSSPSGVSVGRNDSQKSTTSSGYLGSGDEIV
QHDWI
Download sequence
Identical sequences A0A068X7D1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]