SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068X8B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068X8B3
Domain Number 1 Region: 99-223
Classification Level Classification E-value
Superfamily SNARE-like 1.37e-22
Family Sedlin (SEDL) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068X8B3
Sequence length 232
Comment (tr|A0A068X8B3|A0A068X8B3_HYMMI) Trafficking protein particle complex 4 {ECO:0000313|EMBL:CDS26248.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000140100 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MSVLSVYVVSESGSLQMYYDRTNPPVEIVETYNFPLSFVFENVDGRISVVFGATNEVKLG
YCVLAVNGVNANGTVLEDNRDILELFKNPANFPITLHLGSPRLSPNDRITIASMFQAIHH
MARVITPTPANSESGHSRSQVALEPSGIQTIETPETRIHCYESITGTKFILVTDSKIPST
AREALKMVYEAYTDYVLKNPFYSPNQPFNFEFFNSRLKKICDQVENGIYNYV
Download sequence
Identical sequences A0A068X8B3
HmN_000140100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]