SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XA70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XA70
Domain Number 1 Region: 14-146
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 6.93e-29
Family Thiamin pyrophosphokinase, catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 155-233
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 9.81e-20
Family Thiamin pyrophosphokinase, substrate-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068XA70
Sequence length 246
Comment (tr|A0A068XA70|A0A068XA70_HYMMI) Thiamin pyrophosphokinase 1 {ECO:0000313|EMBL:CDS29031.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000847500 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MIVNPFSLIDPDVKIGLICLNSDLKNLTPLFTKLFAKASFSIFVDGFANRIYDSQFKDSH
FPNMVSGDFDSIRPEVKEFYESKNTVQVINTPDQNETDFTKAILLMVENVQTNLDYIVGL
YGSGGRLDHEFGIIKSLYIAKDLSKFPVIIVTEASISCLLEEGENDINMDSFPLHQHCGL
IPLGRPIKTTTSGLQWDLKEDFLDFEGLVSTSNRTVNPTVKVYCDGPLLWTISNPLIDII
KDAESS
Download sequence
Identical sequences A0A068XA70
HmN_000847500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]