SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XB00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XB00
Domain Number 1 Region: 105-153
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000301
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 76-104
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000458
Family Somatomedin B domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068XB00
Sequence length 346
Comment (tr|A0A068XB00|A0A068XB00_HYMMI) RPE spondin {ECO:0000313|EMBL:CDS27977.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000782400 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MLTSLNKTTVLLSVLLLLTTFITEIYSNGSCRNPDGTPICCTGRTNCEGLSPVTHVFYTY
TNRGYKLANPRKPLIQKAKCFCDEYCVRTNDCCSDYREVCSKPKINCEVSGWSRWSSCSR
LCGKGNQTRTRFVVKESQNGGEQCPILMESRACTGYMCNRRRVGRSDYNAYRNMELSSEV
ANLLPVDGDMEEKIKQFDMRWDIRRKLYYGRLIQQNKTDIPDPEPYCVHYEIIKSNEACK
AISTPPEHQQSRFWGQHGSFFDRNYDNDHPWLSTVLLRPGQQICATCYPKYMRPELGNHC
PGTGYPGMTSRWRALNTFDCQGTFRMISVPQRACTCRRQPNSFILT
Download sequence
Identical sequences A0A068XB00
HmN_000782400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]