SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XFA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068XFA4
Domain Number - Region: 194-241
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0445
Family Formin homology 2 domain (FH2 domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068XFA4
Sequence length 280
Comment (tr|A0A068XFA4|A0A068XFA4_HYMMI) Pre mRNA splicing regulator female lethal(2)D {ECO:0000313|EMBL:CDS29512.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000879300 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MALNESNFRTKSSLPDMELIAEEQAIAIGRLENKLKKIEEQNEVLREKLKLCEEDCSLKE
AEYIKNYIASGIRLAQAEFLLPCKRPRLSSQSGADSGKEDVLSEYESPDIIHPALDFIYQ
KAQELIKSVKSEQQQSYDDLLAWKFTPDSASGRRLMTCFRQLLEKNEGLGAINENDSLSK
LESETQVQDSCIRECLKTAQDFNAALLESTVDLDGVQNSLFALKNKLNKAENLIATLKAE
YEKVNPNQSDALIAAALATLSQQAMNPQEEEEVQGEEAAE
Download sequence
Identical sequences A0A068XFA4
HmN_000879300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]