SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XKD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068XKD5
Domain Number - Region: 11-64
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0667
Family CRAL/TRIO N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068XKD5
Sequence length 104
Comment (tr|A0A068XKD5|A0A068XKD5_HYMMI) Mitochondrial distribution morphology family 35 apoptosis {ECO:0000313|EMBL:CDS30525.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000290700 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MPEGKSTSPTREDLQSARLGSLAPECNNLKDEYEQCFFEFFPRFLCGEKFKVDPCATQLD
AYRKCVRCQLESKMGVDLTKLDAQLMSPAEMAEKVARGAANTKS
Download sequence
Identical sequences A0A068XKD5
HmN_000290700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]