SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XL27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068XL27
Domain Number - Region: 19-126
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0306
Family Regulator of G-protein signaling, RGS 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068XL27
Sequence length 129
Comment (tr|A0A068XL27|A0A068XL27_HYMMI) Enhancer of yellow 2 transcription factor {ECO:0000313|EMBL:CDS32878.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000471000 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MNKEREIEFPLCGEICNKELDERIVDRVSDILKTKGIKQIVKNYLPEKLEECGWNKHIFD
ECVKWLKANTASGQRVFYGQKIREEFREPDDVDPRELIEPLLNLGIQLMPECIIQEIKEQ
IIKTLNGEA
Download sequence
Identical sequences A0A068XL27
HmN_000471000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]