SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XLM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XLM0
Domain Number 1 Region: 104-443
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-83
Family Protein kinases, catalytic subunit 0.00000056
Further Details:      
 
Domain Number 2 Region: 13-101
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000673
Family Regulator of G-protein signaling, RGS 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068XLM0
Sequence length 596
Comment (tr|A0A068XLM0|A0A068XLM0_HYMMI) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000485800 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MMDAYEVDFDESGLKIANEIAIKYIRPDAVFKITHFPDELVNDVLSRMEKLDESECPPRD
TFSELICLANSWLKHTVFLAFTKTIYFDRYLQWKWLEMQPVNKDTFRMYRVLGKGGFGEV
CACQVRATGKLYACKKLEKKRIKKRHGEQLAYAEKKILQKVNSRFVVSLTYTFENKDALC
LVLTIMNGGDLKFHIHNMGSTAGFPESRARFYAAEITLGLEHLHSLRIVYRDLKPENILI
DDQGHLRISDLGLAVEIDHHTALKGRVGTAGYMAPEVIRGERYTFSPDWFGLGCIVYEMI
MGQSPFRKRRERLKREEIDRRVCEDVEVYNQRFGETVRDFTSSLLQKDKTLRLGCDERGA
LAVKAHPWFHGMNWKRLEAGLIEPPFTPDPHAVYAKDVLDIEQFSSVKGVKIEAEDINFY
RKFCSGAVSIPWQQEMLETECFDDLNIFYNPDGTLVANLDENAPPSNEDPSKSQCCFPFF
AFSTSSFSHRNSQKNNRAKYDTIANRNNATNNSNDFTLSPTQTTSPASSVTGLVIADHLE
GFAPHLDTKILSTDESGKALLDLAVLRSQALLSSNLDGRIGGDKISSISNSNESSQ
Download sequence
Identical sequences A0A068XLM0
HmN_000485800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]