SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XMP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XMP6
Domain Number 1 Region: 19-157
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.7e-18
Family Nucleoside diphosphate kinase, NDK 0.0017
Further Details:      
 
Weak hits

Sequence:  A0A068XMP6
Domain Number - Region: 163-199
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.023
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068XMP6
Sequence length 216
Comment (tr|A0A068XMP6|A0A068XMP6_HYMMI) Nucleoside diphosphate kinase 5 {ECO:0000313|EMBL:CDS31335.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000347700 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MSADLSNSLQAETNPEITLDKTLAIFKSVAIKKEVSLVDILSKACITVTNRRFVKLSREQ
AMEFYRDRKDEDGYEELVEDLCRDIVLVMVFAKTNIVDMWREIVKYPMTKDTQNNLAKKF
WEEVGSLDDVPFHASETKCNAEWEIRFFFPNTITEPIRTAESARYYLSKNVLPTLLSCLT
EVCKRKPLDPIMFLSDSLLRNNPNQPRTYGEEEDKC
Download sequence
Identical sequences A0A068XMP6
HmN_000347700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]