SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XMR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068XMR2
Domain Number - Region: 69-145
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00301
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068XMR2
Sequence length 195
Comment (tr|A0A068XMR2|A0A068XMR2_HYMMI) Survival of motor neuron protein interacting {ECO:0000313|EMBL:CDS32123.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000409100 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MQVMDCLTQSASANESSDDELLKPALPVVELNDDCLDYSKRYLDPNNYLLYEFRFALDVL
LSSKTVQSTSDELTKALCNNDFFDWLLDNPVKLSYFIDLRQDKLVKLLHELLPVCSPNEW
NSDLQTWLYAALLALEKPLHPNTCSLLRNIAEQFCEHLQVKEFTEDTESNEKRFCYIILS
IIGIAFGQRDIIEDL
Download sequence
Identical sequences A0A068XMR2
HmN_000409100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]