SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XNW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XNW5
Domain Number 1 Region: 255-375
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.26e-32
Family cAMP-binding domain 0.00042
Further Details:      
 
Domain Number 2 Region: 123-250
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.51e-30
Family cAMP-binding domain 0.0000579
Further Details:      
 
Domain Number 3 Region: 4-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000251
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068XNW5
Sequence length 390
Comment (tr|A0A068XNW5|A0A068XNW5_HYMMI) cAMP dependent protein kinase type II regulatory {ECO:0000313|EMBL:CDS32524.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000075900 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MEKNKSDVPDSLVNILQDFTMAVLRNRPTNIPRFAVEYFTELMASEEGNVDAEQTQTSTS
TNSKNISEISEGEIIDDSKTEKLIEEALKRPSQRRNSVSAEPFNPEDEEEINSGEHEKRE
ASFYEKTPKQIERLMEVCRRIVLFSELDDNELTELVNEMFMRSVSPHEDIIQQNDDGDYF
YAIDSGKYEAKIADTESGVQKVVMVYDNEGFFGELALMYNSPRSATVTALTEGILWGLSR
HSFRKHVLTHAAKRRRSFVELLHSVPILHDLTPYQRTSLADNLQRKAVKQGELIIREGDP
GDALYFIMDGFVVVRKKVDQEEIVVNKIGKGGYFGELALLVEKPRAASVYADTDVELARL
GVKSFERLLGPCINLMKNKALEYKTFKDAI
Download sequence
Identical sequences A0A068XNW5
HmN_000075900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]