SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XT94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068XT94
Domain Number - Region: 50-67,118-169
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0575
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068XT94
Sequence length 787
Comment (tr|A0A068XT94|A0A068XT94_HYMMI) Uncharacterized protein {ECO:0000313|EMBL:CDS33142.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000487900 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MSDAAPMLCDNPSPQHLKLPLRSIRTPSPPRRHASPINNSSSHSTTKAAKLVTAIQMGHT
RCLRRYIIDLLDEYSNQKPTSPSIRFKSSILDRRETPPRPDYEWITAKKRLFYDAQGSAY
ITDFEQTSSPLIWAVDCREWSCLRLMCTIQAKEQENSTDECSSTFNGAIYNPSQPQPVRR
RILSTSSSRYPNFLLTSQNCICCAPESSPNRLGDNGGLHHEDIPAALKMRLRPLANLMLS
VSFSNIYSSANVYNTSNGISLSNPKSRSFLDIRSCRSAQNSPRRDRSPSSRSPFTVTTKA
SNSIVLVGCLNTKKHSSRQWKRPTPYRAYWIRGSYTYQSVLDYFFATGFEIVGTHCVTRQ
YTKEDCEHCKQDIDYSDHPNYPTGPLDPRNGIFHDHFSQLERVLQSSGVSANRLDSVMAF
NALAISAGRRLAGWCCHGAEDDTTIGSYTDEPLIEWRILSTLIDHGLNEFEWLEFLSPQQ
NFIGHALCVLAYPIHGWSRAEATSLASHQPKKTSRTFPGFNRTRSRRFRRRSSSPLGRDG
ITNQLPPAPLGAALRRQACLLLINLWSLGAFTSHHIVTRRSRGSTVSGSRIWDPRPSTQR
SHSYTATMEGGDLRRVMLKTLSSRSDQMQMDPLEFLKRWTYFQAVWRSALSGTPLPEALN
GNVSMGLPQLRRHQSPTFQHVPMDSALLKCGSRNIRTYQPICLKLLTRRAVRGYIARAEM
SRRHGSLSALTPVLTIPSLQRFLGYFHSPQHMLGAPLPTALQILLLATASPSGDKSAILQ
CCEEGSN
Download sequence
Identical sequences A0A068XT94
HmN_000487900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]