SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XTR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XTR7
Domain Number 1 Region: 70-224
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.15e-26
Family Regulator of G-protein signaling, RGS 0.00019
Further Details:      
 
Domain Number 2 Region: 837-915
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-26
Family DIX domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068XTR7
Sequence length 917
Comment (tr|A0A068XTR7|A0A068XTR7_HYMMI) Axis inhibition protein axin {ECO:0000313|EMBL:CDS34199.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000572400 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MSYPPGSLRSCHEADGRSDRSGGSGGTGSNSGCGNIYGSLYGSTFSDCKWHHHQQQLQQQ
VQSQSLPQQQLPSTWQKWAASFDALLIDGEGVALFKSYLVSEGCGNLLDFWFAVQGFRSK
VDPSDRKKILQLIKVIYQTYIRGSTSTSTVPPGSSSNSRSRRTHTPVRLRPETRRAIADR
LSHKSSLDQTVFDEAQAEIGHLLRTTAYQAFLKSDAFIKHIQEGSKPPIQSVPGEDFPRQ
YLPTVEEDRELGQQPALKPGSSVTPATYHYFCGPPPPMVQPQQAPPSQQQQCSCQSDGAS
PWALSYYPPPTPRTCYPPAAPLTQENIQMTRFQRAELPVPQHLSCCPHCQTPFQQQNQKQ
AVQQQQTQIASSSNPLSPVQHKSLGRISSTSGPRKWMDAICPKYEYCSPPLPPQGGFPRA
PPNPYHVSFAPVSMQDSEHHSLSSGAHTEESLSHTDGTCDDIRTRMHLASLRHTPRISTN
YPIFEPPTTSLTATTTATLTTNPSSSGVFNSHKYKRGSSSSRRVAANSGSVAAATNKTVT
ATVRDQNLAEQDPTGFAKLLNERLQRVVEDQVAMERLERIMSEVGNEDEQGETGVERVEG
GERQKIPETGPEKDTTSTSTVTTATQRVTEVLRVDTETDTELAKVMDSLSVASTNSTTTT
TTTTTTATSKPSVLQRPWADRLLAAALVQHAKQGDNAQAILEDHCSRIWDTSADRTPTSS
SGSGGNGTHLQQVSSDALRGKPSTSLTTQGRDPVSCRHGPSLETQTQEEDEIEDDAIQPP
LLQESLSPLVTSNTTNSYSQFDFHQQVGEDKLSAELRNQNRCTSSPVASSSNSSGGLVIG
YYLCDDPVPYRSQWPSNVITLGQFKHLVPKKGLFRFFFKTTSDEFDSGVVHQEISNDDAV
LPLWEGKVVAKVERVEQ
Download sequence
Identical sequences A0A068XTR7
HmN_000572400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]