SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XTU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XTU6
Domain Number 1 Region: 230-359
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.5e-43
Family Regulator of G-protein signaling, RGS 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068XTU6
Sequence length 478
Comment (tr|A0A068XTU6|A0A068XTU6_HYMMI) Regulator of G protein signaling 3 {ECO:0000313|EMBL:CDS33481.1} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN=HmN_000091500 OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MSDSHTAEPIQVPDIEITENYSPASHLSSSVERLVEVTRRLTVCNQLESALESHDNVSTS
DQCVCQHDVSPTDVPSELAADKEHKPIIGTASSSAIFDSSNFPIPDGTTRLSPQSNPKKW
ARLLGISPEDIGDEEEFIRAATAFTAQDPIRQANTLSAVEQRVLRKSWNAALDAAHFGSL
ESMEASCGNTLRRSSSWKDKMALPFFSKRCIQVKTIQQDELLKMIASGKPSYEQVHRWRK
SFEALLADKYGLALFKEFLATEFSDENIEFWIACEEYKLITHPKKQQAKAQKIYEDFIAT
QARREINLDSVTRDQTIAELMSPTTHTFENAQKRIQALMERDSYGRFLRSDLFLTLLNQA
KQAARELAAAARDSHEGSSGSFSGDSSSRFRLPSFIVGGVVGGPLRSGGGGGVGTDLPGV
LAAAADAEAGMNSVQDLELLGLSTSRHMRNATKNAAANKRSTSSSGKSSTSPIKPPIR
Download sequence
Identical sequences A0A068XTU6
HmN_000091500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]