SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068XZK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068XZK0
Domain Number 1 Region: 185-316
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.33e-41
Family Regulator of G-protein signaling, RGS 0.0000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068XZK0
Sequence length 393
Comment (tr|A0A068XZK0|A0A068XZK0_ECHMU) Expressed protein {ECO:0000313|EMBL:CDS35536.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000303100 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
METRSHLRILAPTFSNYIHYVAKIFSNLDSNIWCRAASAPLTHTPSSGLHGVDDTTSTAT
AATWLTPSAMNRPRNSPSPETSKPQPSVQMKLRAHTVPVQLQAPSEMTMLRSAASPARIA
NNSTFLALQSTVRNCIPVVLPTSRAPLDLVPEAFCATTTTLKSLQRVSSDENIAASFRVK
KVYLKKVTPEQIRRWETSFNFLLNDSDGLALFEQFLESEFSQENLQFWEACEQYRRLPAK
MLATESQKIYQLYLSVQSPREVNLDSKTRLKTISLLSTPTAHLFDSAQRKIQALMEKDSY
QRFLRAPIFLNFKKSVLANSEVASRAAQSASPRHRRKPTHHGATSIQSVLPNILNVSALP
LGITCIGSYSVIHLPSPTTPSLKGTQKIELLGA
Download sequence
Identical sequences A0A068XZK0
EmuJ_000303100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]