SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068Y1P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068Y1P8
Domain Number 1 Region: 1274-1368
Classification Level Classification E-value
Superfamily Immunoglobulin 4.31e-22
Family I set domains 0.027
Further Details:      
 
Domain Number 2 Region: 120-220
Classification Level Classification E-value
Superfamily Immunoglobulin 8.49e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 33-124
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 416-530
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 5 Region: 818-914
Classification Level Classification E-value
Superfamily Immunoglobulin 6.33e-19
Family I set domains 0.032
Further Details:      
 
Domain Number 6 Region: 327-428
Classification Level Classification E-value
Superfamily Immunoglobulin 4.09e-18
Family I set domains 0.0085
Further Details:      
 
Domain Number 7 Region: 725-820
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 8 Region: 637-730
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 9 Region: 1003-1099
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-16
Family I set domains 0.034
Further Details:      
 
Domain Number 10 Region: 227-333
Classification Level Classification E-value
Superfamily Immunoglobulin 2.71e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 11 Region: 1185-1280
Classification Level Classification E-value
Superfamily Immunoglobulin 7.74e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 12 Region: 528-635
Classification Level Classification E-value
Superfamily Immunoglobulin 7.88e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 13 Region: 1092-1186
Classification Level Classification E-value
Superfamily Immunoglobulin 7.89e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 14 Region: 1364-1414
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000445
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 15 Region: 1421-1471
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000706
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 16 Region: 1534-1594
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000641
Family TSP-1 type 1 repeat 0.00022
Further Details:      
 
Domain Number 17 Region: 904-1001
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000009
Family I set domains 0.0096
Further Details:      
 
Domain Number 18 Region: 1477-1535
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000116
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 19 Region: 1593-1648
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000942
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 20 Region: 2022-2167
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 21 Region: 2119-2244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 22 Region: 2249-2365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000115
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 23 Region: 1785-1991
Classification Level Classification E-value
Superfamily GFP-like 0.0000000523
Family Domain G2 of nidogen-1 0.0076
Further Details:      
 
Weak hits

Sequence:  A0A068Y1P8
Domain Number - Region: 1668-1732
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000209
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068Y1P8
Sequence length 2521
Comment (tr|A0A068Y1P8|A0A068Y1P8_ECHMU) Hemicentin 1 {ECO:0000313|EMBL:CDS36996.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000422300 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MPDLTVTTQDAFKTERFKLRHDVSYAGPPRFLFTSEEGTQGVPLGGSVALFCVAEGEPKP
MIRWTKDGAPITEAQGRFQISDDGVHLRLPAAEENDAGRYSCIASSPYGEVSKHFDIKVI
YAPRLDGDGQRQYSIERTVGSSVILECLVIGNPTPSIEWYKDGSKLEPLPYRYRLLNQKR
ELEILSIQPVDAGRFRCVASNEAGSLEVSVDLTVGAPPRIDRGRLRSEYVVKEGDELVLP
CPATGSPDPRLSFTRSELDLTTQTVVERPLGEQGTASDKDSLVRRAVVSQDRQALTIFRV
QKSDAGTYQCNASNEIGWDTMKYTVRVRVPPSFDTSNMQPEVQWFVNQTRFLDCPLHGFA
DPPPLLTWERHGISVVSGPAIQISADGSRLTVPRVSLSDAGDYKCIASNEVGRTSQTFHV
LVHVRPRFMDPMRKINIEAIQNQTIYMSCEATGDPPPRVTWFKRDVELFPPGSFLTSSST
QDSHKTVMPLQGDQILQITNVQKSDAGDYACMASNGGEAIEKKFNLTVIMPPVILKPQGS
PEVHSTREYVPETFHCLIRDYNSTQPEIVWTKDGSPILMSEDGDYFVVQDSGQVLTVVRP
TSSESGTYRCEAKNKAGVDSHYFKLIVTAAPRFPTDFVRYREKLTQQIGSQVRLTCPVTG
SPPPVVTWYYNGSPLLPYTVPSHYSFDMDNRVLNFISGQKDSGEYRCIAHNEAGNISKTY
ELEIIMPPLVRLDRAEMREREGSTFTVQCIAEGHPPPKIEWTRSTGGLFRIGTNVDLATG
ILTITDARKEDTGVYTCTATNKISSDSKTVDIQVIERPLIQTTTAPVVVNEGDQVVLPCT
VTGTPPIQVQWRLPSGQQITQDEILGFQVLPQQGLLIESATRTHAGLYRCSASNEAGSQN
AVISLEVLVPPKLVRPATIEASGKMNSVLQLNCEVEEGIPKPIVIWERNGVSFSRTKSFY
TTTDSGLFIFNALKPQDEGEWICVARNPAGEDRLAFNVIVSTPPRVSMSLSSVGYEGQSI
TLDCQVEGKPIPEVVWEFKNEPVAMTFGSRARLDSPTRLTIHNLQPDDAGNYFCIASIPG
QDRVMDSTYLTVFTIPTFVSTPNRTIDAFEDRWIQFRCTADGHPKPEIKWTFKGNMIGSN
PSHNGIGSLIIGPLRESHSGQYACIATNDAGKKEHAFQFTVKTRPKVHMYQSDEAIRTNE
MARLYCNVSGDADSIVWLKDGIPIESDQRVNIENDGSSLVISMARSVDNGVYQCIAANPV
GEDLGELRLVIESKPQLVKTPANSTASLGEIITLECQAEGHPTPIISWYHNNVTVRMSST
HSVIRNGSLRIVGVSEKDDGIYHCVASSYQGEAISNPATVQVQIPGGWSEWMPWQPCSAT
CGRGVQMRERLCESPAPRNGGAYCVGENAETRACLQAFCPVDGAWGSWGPWSACSSTCGA
GLRHRSRKCDSPPPGNGGKPCPGEAMEDVLCEDLPLCPVKGGWSSWGPWSSCSRTCGAGS
TQHRERKCDMPPPANGGLLCIGPESQVRACERKPCPINGSWGQWSAWSHCSKSCGGGIRR
RTRQCNNPSPRFGGAPCQPQGGDSETTECQENPCPVNGEWSNWSSWSACVGRCGVGIQSR
TRTCTEPAPSYGGHLCRGSAKDSRTCSLPFVDDSEPCPIASGSGGGVGANWSSWSAWSEC
VPDCSSTEGESGEGGRRHRTRNCMTLRDGKYVAAQSIRECEGHAEEIEKCYPPASGSLDC
FDQNRPLFGNLIGELRGRLGEKSLAGIKIVGNWSAMSPKVTSFRINFQNVPPEHSLCLQV
LSEMASPVFWYAAREIERASNGEYVTGRSGEFTWNSLGQFADGSNVRLDLVLRRDNDEDY
SSEQKFVVLRMEATIIGDCPIALQPDAVEDKDVPAWSAGAKAELSDFKEQIVQLDPSKGK
LHASSSRTYGVVDWTSGRRLIEPYGWNSEVTTSSGRRQRFLSQNLIVDRLFVVSDPARGV
ISLSADTAISKVSGAVCPEGFEIVEARMDGKRQLLGAANLDYCRDVNECSSPNLNTCDHI
CENTSPGYSCKCHEGYRLSPDGRSCLDIDECMEGENAGILVCPMGQRCVNKPGTFNCVQG
CSEGLQLSASGDLCEDIDECRSGKDVCNGHKCVNTYGGYVCSCRSGYELINNHCQDIDEC
KNGKASCRSNEACVNLPGWYECRQVCPRGYRFAGEMADGVPNCIDINECSTNENLCPAEA
VCINEPGSFRCQCPDGQPPIKHSCLGLSSRACEPGFTWDSESARCADIDECNPAYGPGPC
QYECHNTYGGYRCSCPLGYELNPLTNLCKDTNECKTSANTCKKGELCINTPGSHMCIKPD
CPESYQWDDKTQSCRILCTESDLPCPKGARYADSVQYISVSIPRTNGTINRNIMLRVVDW
NQVQQGNCHYQLLDKASGTPVSHRSKNGVVYLIPDWTSPAFADPGSKVIHASLNQSAPAL
YYLFFRVSCYEGLPRYTTTNSQDFDVYPVGRQLQQVAYRDDSKLIFQHSFYVYISISNYP
F
Download sequence
Identical sequences A0A068Y1P8
EmuJ_000422300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]