SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068Y2X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068Y2X1
Domain Number 1 Region: 6-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000222
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068Y2X1
Sequence length 86
Comment (tr|A0A068Y2X1|A0A068Y2X1_ECHMU) cAMP dependent protein kinase regulatory subunit type I II alpha beta {ECO:0000313|EMBL:CDS36790.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000395400 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MSICDRPRLPEGFQELLEELSYEVMVERPADVIQFSIDFFKSRRGPNGTCISKKAASRRA
SDDPLGNDRSLHLSSCPRDKFTQRPQ
Download sequence
Identical sequences A0A068Y2X1
EmuJ_000395400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]