SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068Y399 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068Y399
Domain Number 1 Region: 159-208
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000471
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 91-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000122
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 213-265
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  A0A068Y399
Domain Number - Region: 402-479
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00664
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068Y399
Sequence length 661
Comment (tr|A0A068Y399|A0A068Y399_ECHMU) Titin {ECO:0000313|EMBL:CUT99616.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN= OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MTRTMFNSAVIFGYFSLALQAINADLIAHCQEKSVWGPWRCPGSFGRCTDKVATRYKCPE
GDCVEGSQCTSLPGFMQTKNCGEALGRGECRPFWSSWTSWSACSATCGVSERSRYRPCSG
AYTATSTAEVEESCADPAKAAEGLQKRDCPLQRLCPRIAGGWGEWSAFSACDATCGRGSR
RRIRLCNRPPPQGGGVPCQGIDTQEVECDVGVPCAVDGSWCPWSGTVVKCSAACGDSGMG
LRTRLCACPSPAHGGKSCSLPPGAKEAAMLALSYLQDAAIRKGTSGGKGDGDDDFPMPTA
ADIAAIADGSGKWDACNRKFCPYLKRLTDFEVNITIDDLRLQRPEDAWLWSGGIPSSRHD
PVGLHCSPQLRSRTKIYDKRYRFPRARAMWTRSVGRSEYQSYDFVGTPLRANRRLQILRD
RLIIRSLDEADEGVYRYGYEYEPLQFATICFFAVYLSDKVAVIESGKPFKLTCNAKGLWP
IIQQTPKDNWKTFWAYRPDAKAAALGIKPIKELWLVDLKPPCIMEEEDIFMNTTERTMVM
TLFDTERRQFDAVAYAMSGYYQCIVQNSPKGLGERNFVTNAVQLIVVSPPTLTEKLKKWI
VKHWRAIVYLLLTLMVVTLFYILLIRLRARRVASLRNWEALEEAKKRAKLITAGEIKVKT
K
Download sequence
Identical sequences A0A068Y399
EmuJ_000672900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]