SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068Y6M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068Y6M8
Domain Number 1 Region: 218-342
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-31
Family cAMP-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 90-212
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-30
Family cAMP-binding domain 0.00000922
Further Details:      
 
Domain Number 3 Region: 4-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068Y6M8
Sequence length 367
Comment (tr|A0A068Y6M8|A0A068Y6M8_ECHMU) cAMP dependent protein kinase regulatory {ECO:0000313|EMBL:CDS40189.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000775600 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MSKKTVDVPAGLREILQDFTVAVLRNRPSNIINFAAEYFEMKKNQQKENEDAESEEEIMA
PPIRARRRQGVAAESYDPEKEDKFEKVVYEKTDEQRQRLANATKGILLFRCLDEDQMRDV
IDAMFERKVDVGEKVITLGEDGDNFYVIEKGVYDIIVKVDGVEKKVGQYDNNGSFGELAL
MYNTPRAATIQATTPGILWAMTREVFRSIVLKSAFKKRQMYEELLNQVPILQSLSAYERM
SIADALHTQIYEGGTKIISQGQEGDEMYFVEDGEVRITMKKSGSDEETELTRIKKGGYFG
ELALLTKHPRAASAYAVTRTKLALLDVGSFERLLGPCLDILRRNIDNYENQLKSVFGSLD
NVPELRH
Download sequence
Identical sequences A0A068Y6M8 U6IUI1
EmuJ_000775600.1 EgrG_000775600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]