SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068Y9K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068Y9K4
Domain Number - Region: 10-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00068
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068Y9K4
Sequence length 73
Comment (tr|A0A068Y9K4|A0A068Y9K4_ECHMU) Nucleoside diphosphate kinase 5 {ECO:0000313|EMBL:CUT99316.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN= OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MEPIPTKQYAKDYLSKNVIPTLLTGLTEVCRKKPKDPVIFLAEWLLQNNPNQPGTNELCP
QIEVPNQESKLQN
Download sequence
Identical sequences A0A068Y9K4
EmuJ_000638900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]