SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YAT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YAT8
Domain Number 1 Region: 338-471
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.97e-42
Family Regulator of G-protein signaling, RGS 0.00000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068YAT8
Sequence length 478
Comment (tr|A0A068YAT8|A0A068YAT8_ECHMU) Regulator of G protein signaling 20 {ECO:0000313|EMBL:CDS41657.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000932600 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MASGPLVFIHPAIEEGSANSPSSGHNKSEDVVLRRVGDAYFYWNAPTAPNQTKQQATASS
TWDLSADHLLSTDWFSSPRGHSDPNLQKNSPSCFSTELTFNNCMCGSSANSSSAIGPTPC
SPTPPSAGTTTMTPNDHWVLPWQSGQRTSHGLNNEEDFFNSRSFFADVGSMATTIVNNRG
GFFPPPPAPMALPPSTLLTTNSFEGAPFLRQISGNTQTGVEVPSSITRRPGANGSSSTST
SAAGNRITSTNSLQAAVFPRREGTISPLNRRSSATEYGQHSFIGHGCAYKSLLLLLVLLL
LLLMRACQTSPRAEQTINSHSLDDPHRTETQLLELRTTYEDILSWSESFDTLMRCFTSPD
GAVGQKAFREFLRSEYSEENILFWLACEDLKQETKPEVVEEKARLIYEDYISILSPKEVS
LDSRVREMINTNMTQPTPHTFDEAQLQIYTLMQRDSYPRFLNSRIYKDLLAMTKGDSS
Download sequence
Identical sequences A0A068YAT8
EmuJ_000932600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]