SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YBP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YBP4
Domain Number 1 Region: 5-163
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-20
Family Regulator of G-protein signaling, RGS 0.0089
Further Details:      
 
Domain Number 2 Region: 164-302
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.59e-16
Family Regulator of G-protein signaling, RGS 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068YBP4
Sequence length 308
Comment (tr|A0A068YBP4|A0A068YBP4_ECHMU) A kinase anchor protein 10 mitochondrial {ECO:0000313|EMBL:CDS39734.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000727850 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MSSGFSRLCPSFANVINDPLLLSYFIQYLRSTNSENIFRFWLELSGCMSRRNNNGDSFKF
KSEESVSSDKTVDELREKISHLPVNSITTIYFRYISREAKLPVELPPELLSATLLRILEN
PYNIAAFGPCLRFTESKLHSSLFPDFLRSDFFSEFCVEIIVNDQLTLSDVLFEEALLVNF
IEFLAGDPTSILLTFLMAVNAYKKEFSELMLKKDHAESVEERHQQLLHDATTICAKYLSP
ASDDFMGLTLEQYRSVLDVACAEKEPRENCFDDLYKLIYKTVEKNILPSFFVSSPFSRYR
SKFVQKPG
Download sequence
Identical sequences A0A068YBP4
EmuJ_000727850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]