SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YEA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068YEA8
Domain Number - Region: 107-154
Classification Level Classification E-value
Superfamily IpaD-like 0.0523
Family IpaD-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068YEA8
Sequence length 203
Comment (tr|A0A068YEA8|A0A068YEA8_ECHMU) Expressed protein {ECO:0000313|EMBL:CDS40538.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000813200 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MLETLEPHLVKEICSSFNQMNEVYVSICECSANLASQHRRKSRVDEHCIDFGMTVSNDEH
LSSYVSARVRACVTLSFGASVAHGSGKVADLLNLLRLLALRIFSLCESLTSALKKTIAKE
SCDLSAFNNIVEALTEMTESMVDEIDLVSQWVYSNALPEFVATSVSSPFKFASSCLSDKL
LSRTLWREEVYPLLKFTNMFKCF
Download sequence
Identical sequences A0A068YEA8
EmuJ_000813200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]