SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YIK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YIK7
Domain Number 1 Region: 500-558
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 217-280
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000667
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 618-680
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000114
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 374-457
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000144
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 148-213
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000405
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068YIK7
Sequence length 723
Comment (tr|A0A068YIK7|A0A068YIK7_ECHMU) AdamTS protein 3 {ECO:0000313|EMBL:CDS41997.2} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_000969100 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MEGRGRGWSKEISCLFKPSPLFHFHIYANPTELDTFKGQLNSALVFVDQQPQYLCPIYLH
QLSYPRDGDILLRRHLIFVTIICCCFNCKNLCIKSDHSCFFAFPLESAFLPPCRNLMPTA
FMASPLFSSMWILLFFFVALQCNIISPGGPEWTATDVWDRCSSVCSPGLQHKVYVCVQHD
RYNTTTLRPEKFCGSLTSKIPPNATRECNWGDCESKTWWRASNWSDCSQPCGNLGYTTRE
VECVMAGDEDEITISHKFENDFCDPKKRPESQGACNRFNCPAEFQALDWQKCEQKDPCKS
GLQKRLLSCRSLTASGQYVELPQIACYLSRKPPPSIWRRCFIPEISAQCTQNPPVIEKMK
MTVVQMRAVRRMRLQVGQEAHILPDTRLSIKCPVKFFPGSNLIWQHSKLGNFSYHAGGVS
NETNRCFISKSGNLVIRHFSSSDEGEWRCQAGKEGPSASIMLHYNLPSQGLADWEARNPK
RSTEMQNEDPAVIMTRQKLVQWVEGPWSNCSVPCGGQGIQTRVVRCELLDTGVYHVLDDE
ECKRQFLVKPITQRVCINLPKCPMWKLRNADYSECTDHCVSVGRGTYGGHLACMLGGVEI
PAHHCKQMTKPDITCENSFCQAKWVVSEWSKCSVSCGGTGYQYREQKCVWEHSGQSAGSA
CYDAEIEAPAAVQQCQTRPCKTLCIDLSDHCPKYRHWCSFHTFKYNCCKTCRDYVLQLNQ
AGD
Download sequence
Identical sequences A0A068YIK7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]