SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068YK32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068YK32
Domain Number 1 Region: 74-236
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.09e-26
Family Regulator of G-protein signaling, RGS 0.00013
Further Details:      
 
Domain Number 2 Region: 841-919
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.34e-26
Family DIX domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068YK32
Sequence length 921
Comment (tr|A0A068YK32|A0A068YK32_ECHMU) Axis inhibition protein axin {ECO:0000313|EMBL:CDS43633.1} KW=Complete proteome; Reference proteome OX=6211 OS=Echinococcus multilocularis (Fox tapeworm). GN=EmuJ_001141200 OC=Cyclophyllidea; Taeniidae; Echinococcus.
Sequence
MSYPPGSLRSCHEADGRSDRSGGSGGTGSGSGCGNVYGSLYGAFSDCKWHYQAQQHQQQP
HHQDQKLQQQLGQVQSTWQKWAASFDALLNDGEGVALFKSYLESEGCGNLLDFWFAIQGF
RSKVDPSDRKKILQLIKVIYQTYIRGSTSASAVASSSGVPPPSSTTTSRSRRNHTPVRLR
PETRRSIADRLAHKSSLDQTVFDEAQAEVGHLLRTTAYQAFLKSEAFIAHIQQGGLGPKP
ALMCSEDEFTRHTAYLPTVEEDRELGQAPLPLRGSSTPATYHYFCGPPMLQQQCACQSGN
PWGVTYYPPPTPQTCYPPAPLTQENIQMTRFQRAELPVPQHLACCPHCQTPFPQQQQIPG
PSNPLSPTQHKLMGRMTGAGQRKWMDAVCPKYEYCSPPLAPQGGFARAPPNPYHVSFAPV
SMQDSEHHSLSSGAHTEENLSHIDGTCDEARSRMHLSAIRHTTRISTNYPVFETSTTTTP
AAVITSDGGGGGGGALGHKHKRGVSSSRRAAANGASTAAAGVAAASKTATLRDQNMAELD
PSGFARLLNERLQRVVEDRAAMERLERLMSEVGNDEEGEETTEIPDTGQEKEASTKTTEA
VKVEPKTETEMASATKTQQPQPLLTTAESEECSISKAMANLSVASISTTTTTTTTTTTTA
TVSTKSSVLQRPWADRLLAAARVQHAQQGDNAQAILEDHCSRIWDTSADRTPTSSSGSGG
DGHGASALRPRLDAVGKSSGKIVETSRQATTGGGGEEEEVEDDCIHPPLLQESSSPPSAT
TTTTTNSSTRFDFHQQVNESQLVDVNTMRLQARCTTLPTAPSTTGGGGSVGSGGSSGSGG
LVVGYYLCDDPVPYRSQWPSNIITLGQFKHLVPKKGLFRFFFKTTSDEFDSGVVHQEISN
DDAVLPLWEGKVVAKVERVEQ
Download sequence
Identical sequences A0A068YK32
EmuJ_001141200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]