SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069AQQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A069AQQ3
Domain Number - Region: 34-135
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0876
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069AQQ3
Sequence length 139
Comment (tr|A0A069AQQ3|A0A069AQQ3_CLODI) Uncharacterized protein {ECO:0000313|EMBL:CDT35382.1} OX=1496 OS=Clostridioides difficile (Peptoclostridium difficile). GN=BN1095_440160 OC=Peptostreptococcaceae; Clostridioides.
Sequence
MSLYKFIYDDKEYLLKEENCSALINDEENPVQGVSISKIIDILNEAEEVDFDVEYYQEAC
PLCLEGVKEKKKFFPFLEYHFYIFSKDGEYVISNISVNYKGLSFNKLSRANKVDNSYIVS
VIICENCQDYIIQIENCIV
Download sequence
Identical sequences A0A069AQQ3
WP_021367033.1.10483 WP_021367033.1.10793 WP_021367033.1.11320 WP_021367033.1.11937 WP_021367033.1.13273 WP_021367033.1.13730 WP_021367033.1.14177 WP_021367033.1.14259 WP_021367033.1.14686 WP_021367033.1.17611 WP_021367033.1.1838 WP_021367033.1.20960 WP_021367033.1.23208 WP_021367033.1.26024 WP_021367033.1.26940 WP_021367033.1.30463 WP_021367033.1.32776 WP_021367033.1.38338 WP_021367033.1.39874 WP_021367033.1.43112 WP_021367033.1.4383 WP_021367033.1.44149 WP_021367033.1.50159 WP_021367033.1.53055 WP_021367033.1.5521 WP_021367033.1.56006 WP_021367033.1.59628 WP_021367033.1.59752 WP_021367033.1.59990 WP_021367033.1.60482 WP_021367033.1.61140 WP_021367033.1.64092 WP_021367033.1.64546 WP_021367033.1.65369 WP_021367033.1.69708 WP_021367033.1.6994 WP_021367033.1.71079 WP_021367033.1.71384 WP_021367033.1.7199 WP_021367033.1.75026 WP_021367033.1.76550 WP_021367033.1.76664 WP_021367033.1.7916 WP_021367033.1.81035 WP_021367033.1.83287 WP_021367033.1.84923 WP_021367033.1.86088 WP_021367033.1.87714 WP_021367033.1.882 WP_021367033.1.91648 WP_021367033.1.93717 WP_021367033.1.94073 WP_021367033.1.94968 WP_021367033.1.96113 WP_021367033.1.96503 WP_021367033.1.96690 WP_021367033.1.98715 WP_021367033.1.98997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]