SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069DLU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069DLU6
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily Lipocalins 5.78e-21
Family Hypothetical protein YwiB 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A069DLU6
Sequence length 139
Comment (tr|A0A069DLU6|A0A069DLU6_9BACL) Uncharacterized protein {ECO:0000313|EMBL:GAK43316.1} KW=Complete proteome; Reference proteome OX=1499968 OS=Paenibacillus sp. TCA20. GN=TCA2_5812 OC=Paenibacillus.
Sequence
MSGWNPVKVHIYSMADGEKVIQTFTGEAIRKGSALYVRYEEEEQVPGGSRIRNTIKVTAH
SLKLIRHGGVESEQNFELGQRLPGFYKSPYTSFALSTDTKKLEIRTAGMSAKLAFRYDLY
MFEEKSGRFDISMEIQEEL
Download sequence
Identical sequences A0A069DLU6
WP_047914334.1.55887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]