SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069DLX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069DLX1
Domain Number 1 Region: 182-230
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000101
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069DLX1
Sequence length 248
Comment (tr|A0A069DLX1|A0A069DLX1_9CNID) HlhIE-2 Helix-loo-helix transcription factor {ECO:0000313|EMBL:JAC84958.1} OX=252671 OS=Clytia hemisphaerica. GN= OC=Campanulariidae; Clytia.
Sequence
EMVKHLDENQTAVKTKTKTKRKTCRRTKKNINSKDKAKKMFPPIEQDHQQMLFGDQYVPD
MRYLPNIKLEPYFETAYYPTSSHSIDLNTTKFNLIDKNSFHTPCFDGYHTTTTNTNLLNL
GREPSPTHLGPDTDQSLTPNLPCDTGVKPQKIAKKTRTRKSRNSSTCGKVRSRLSSDSGL
PREKDRARVFNEAFEGLRKRIPSIPATKKLSKIEILRLAICYMSYLKFVTTDDPFLVSVD
KESADQLS
Download sequence
Identical sequences A0A069DLX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]