SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069DN00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069DN00
Domain Number 1 Region: 56-167
Classification Level Classification E-value
Superfamily C-type lectin-like 6.36e-43
Family Noncollagenous (NC1) domain of collagen IV 0.0000143
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000172
Family Noncollagenous (NC1) domain of collagen IV 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069DN00
Sequence length 177
Comment (tr|A0A069DN00|A0A069DN00_9CNID) Collagen protein {ECO:0000313|EMBL:JAC85016.1} OX=252671 OS=Clytia hemisphaerica. GN= OC=Campanulariidae; Clytia.
Sequence
MPFMFCDLQNQCTVASRNDYSFWLSTPEPASMMAPAKGPEVRPYISRCSVCQAPANVMAV
HSQSSTIPSCPAGWNGLWRGWSFLMYNSAGAEGAGQLLSSSGSCLQEFRVNPYIECHGRG
TCHYFGPTLSFWLSTIDEQSQFSVPQSETIKSGRLRERVSRCQVCVKDVSQPDNNSP
Download sequence
Identical sequences A0A069DN00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]