SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069DR54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A069DR54
Domain Number - Region: 25-99
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0115
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069DR54
Sequence length 233
Comment (tr|A0A069DR54|A0A069DR54_9HEMI) Putative lish motif-containing protein {ECO:0000313|EMBL:JAC86132.1} OX=65343 OS=Panstrongylus megistus. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Panstrongylus.
Sequence
MSYSDKPPEYTREEWIKKLESMHVQRSDMNKLIMNYLVTEGFKEAAERFQEESGLVPPID
LNSMDNRIQIREAIQNGRTQEATLLVNQLHPELLDNDRYLYFHLQQLHLIELIRDGKVEE
AVHFAQSQLSECGESQPAILNELERTLALLAFDHPLMSPFSDLLDMRHRHKVASEVNTAI
LKTEHHESTHPRLYALVKLILWCQDELAKRNLKFPRMVDLSTTDIVESTPAAK
Download sequence
Identical sequences A0A023F2H2 A0A069DR54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]